PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G0055
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 176aa    MW: 19210.9 Da    PI: 7.0014
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G0055genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.51.9e-42121111100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da+sslvyeA++r+rdPvyG++g i++lqqq+++l+ae+++++
  Gh_D13G0055  12 PCAACKLLRRRCAEECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPENQRADAASSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAEINAVR 109
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_D13G0055 110 AE 111
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.58611112IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4212109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGSHGTLNTI TPCAACKLLR RRCAEECPFS PYFSPHEPQK FASVHKVFGA SNVSKMLMEV  60
PENQRADAAS SLVYEANVRL RDPVYGCMGA ISALQQQVQS LQAEINAVRA EILKHKCREA  120
NLIPSSSHLA LLSSGAVSIA TPPPMPLPQP TTAADYNTIS DENVTYTLDN KYYLDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-491212611125LOB family transfactor Ramosa2.1
5ly0_B6e-491212611125LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots and at low levels in flowers, but not in leaves or inflorescence stems. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465673.11e-128PREDICTED: LOB domain-containing protein 15-like
SwissprotQ9AT614e-68LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A2P5R1F11e-128A0A2P5R1F1_GOSBA; Uncharacterized protein
STRINGGorai.013G005900.11e-127(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-66LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]