PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G2611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Dof
Protein Properties Length: 304aa    MW: 33756.9 Da    PI: 7.0122
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G2611genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.34.6e-4051111262
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  +e+alkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+ 
  Gh_D12G2611  51 HEQALKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVV 111
                  7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2949109IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3353109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05955109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGLTSLRVCM DSSDWLQGTM HEESEMDSSS LSGDMLTCSR PLVERRLRPQ HEQALKCPRC  60
ESTHTKFCYY NNYSLSQPRY FCKTCRRYWT KGGTLRNIPV GGGCRKNKKV VSKKPNTDQS  120
SNSNNNVVGS SNAHHHNPTH LHLSFPEMHL NNMLATHHAA DGNFIGGNKY NSLLGNPMPI  180
DFMESKLEAI VGSSRNYDFL GNGNEMGLVE GVGDMGIAPN LHGLCSPYGM STIDGTGGGF  240
MMLPYDTNED QQHAIDVKPN NKLLSLEWKD QGYPDAGKDS YGYMNSLGSW PGVMNIMDPP  300
QQIH
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the vascular tissues and pericycle of primary roots. Detected in the vasculature of the cotyledons, rosette leaves and cauline leaves. In flowers, localized in vasculature of petals, stigma, and stamen filaments, and, to a lower extent, in anthers and carpels. In inflorescence stems, accumulates in the vasculature, particularly in cambium, phloem, and interfascicular parenchyma cells. {ECO:0000269|PubMed:19915089}.
UniprotTISSUE SPECIFICITY: The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). Preferentially expressed in the vasculature of all organs, including seedlings, roots, stems, buds, leaves, flowers and siliques, and particularly in the cambium, phloem and interfascicular parenchyma cells of inflorescence stems (PubMed:19915089). {ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6501060.0HQ650106.1 Gossypium hirsutum clone BAC 067L14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440415.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM039e-46DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A2P5QC840.0A0A2P5QC84_GOSBA; Uncharacterized protein
STRINGGorai.008G295600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.13e-46Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]