PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G2056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 370aa    MW: 40971 Da    PI: 10.2423
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G2056genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32189242255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gh_D12G2056 189 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 242
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15186242IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28187242IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-23189242IPR006447Myb domain, plants
PfamPF002492.4E-7190241IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MELFPDLSLQ ISPPNPKPTS TCRTREEDID LGFWKRPLDS RNSISSMAKP DNCIDLSLSN  60
PRISESNSNH LQLLHNGTAN CNGLLLLMKK RKEKIEKKKG KKKEKSSXLG QELGFLRPIR  120
GIPVYQNPPP PPFPFAQQPL DSSLASSPSS LASNTINTSS TSLSPFQSQG LMRSRFMSRF  180
PAKRSMRAPR MRWTTTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY  240
RTVKTTDRAA ASSGQSDAFE NGSSGDTSED LMMDIQNPRR SEVSVQQGRS SSSSNAYQDK  300
EYHGLWSNSS REAWLHGKPK DSAGNVPSLQ KDMDPKCLSH ERVSDGSSSS LSGTSPKKPN  360
LEFTLGVLPH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431301e-171AC243130.1 Gossypium raimondii clone GR__Ba0240C19-hnz, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439289.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6163e-89KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0B0MAU30.0A0A0B0MAU3_G
STRINGVIT_02s0012g01940.t011e-178(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-72G2-like family protein