PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1504
Common NameSPL19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 302aa    MW: 33271.9 Da    PI: 8.2524
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1504genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322e-4124100278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  C v+gC+adls++++yhrrhkvCevhsk+p+v+++g+eqrfCqqCsrfh+l efDe krsCr+rL++hn+rrrk+q+
  Gh_D12G1504  24 CLVDGCTADLSKCRDYHRRHKVCEVHSKTPKVTIRGQEQRFCQQCSRFHSLVEFDEVKRSCRKRLDGHNRRRRKPQP 100
                  **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-341785IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.0772198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-3922104IPR004333Transcription factor, SBP-box
PfamPF031102.2E-302497IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MESSSSASFK RARAPATGNQ VPSCLVDGCT ADLSKCRDYH RRHKVCEVHS KTPKVTIRGQ  60
EQRFCQQCSR FHSLVEFDEV KRSCRKRLDG HNRRRRKPQP DFMSVNSGRF PYNHQGTRYF  120
PIGSSQMHSW MGGVKVESDM KLINFSGGNS LFPGFSSDNH HKGEKHFSFL QTTASSHPGS  180
GSLCQPFLEA SSSGDNSRKM FSDELNQAID SDRALSLLSS QPAETREIGL SPMVQPASAS  240
FVIPNLQFND VGGMGGEPIG TSILDADGGG NNSHLQGHEM FQNEHFGSSA TGAHHTLSFS  300
WE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2924971184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18097KRSCRKRLDGHNRRRRKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223270.0KJ622327.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL19) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438339.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_012438340.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_012438341.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_012438342.10.0PREDICTED: squamosa promoter-binding-like protein 16
SwissprotQ49I554e-59TGA1W_MAIZE; Teosinte glume architecture 1
SwissprotQ49I573e-59TGA1B_MAIZE; Teosinte glume architecture 1
TrEMBLA0A088DK050.0A0A088DK05_G
STRINGPOPTR_0003s16780.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-47SBP family protein
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]