PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 987aa    MW: 109592 Da    PI: 6.425
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1220genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322e-41155232178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C adls+ak+yhrrhkvCe+hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Gh_D12G1220 155 VCQVEDCGADLSHAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNP 232
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.7E-34149217IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.214153230IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.27E-38154236IPR004333Transcription factor, SBP-box
PfamPF031101.3E-29156229IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.19E-6757870IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.204.8E-5758871IPR020683Ankyrin repeat-containing domain
CDDcd002043.44E-6759870No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 987 aa     Download sequence    Send to blast
MEVRVGNEAR PFYGMMNPVG LPAVGKRTLE WDLNDWKWDG DLFIASSINP VSADSMGRQF  60
FPIGSGIPGN SSNSSSSCSE EVNPETEKGK RELEKKRRVI VVEDDGPNQE AGSLSLKLGS  120
QGGHGYPVSQ REMRNWEGTN GKKTKLSGGS GNRAVCQVED CGADLSHAKD YHRRHKVCEM  180
HSKASKALVG NVMQRFCQQC SRFHVLQEFD EGKRSCRRRL AGHNKRRRKT NPDAIVNSNS  240
LNDEQTSGYL LLSLLRILSN MHSNRSDQTT DQDLLTHLLR SLASRTGEQG GKNMSGLLPE  300
ACDLEAVSAL FSNGQGPPRP FKHHITGTAS EIPHTGRKSC DTKGAEVPSN TAGAVKINNF  360
DLNDIYIDSD DETDGIERSP APVNAGTGSL DCPSWVQQDS HQSSPPQTSR NSDSASAQSP  420
SSSSGDVQSR TDRIVFKLFG KEPNDFPLVL RAQILDWLSH SPTDIESYIR PGCIVLTIYL  480
RQADAAWDEL RYDLSFSLSR LLHCSDDTFW RTGWICIRVL DQIAFIYNGQ VVVDTSLPLR  540
SNHYSKIMSV KPIAISATER AQFSVKGINL SQPATRLLCA VEGKYLVQEA THELMDDSDD  600
LKEQDELECI NFSCSIPNVI GRGFIEIEDH CLNSSYFPFI VAEDDVCSEI RMLESVLETT  660
DTDADIGRCG KMEAKNQAMD FIHEVGWLLH RSQLKSRLGH LDPNPELFPL RRFKWLMEFS  720
MDHEWCAVVK KLLNILLDGI VSLGEHPSLN LALTEMGLLH RAVRKNCRPL VELLLRFVPE  780
KTSDRLGFEN ETVADGVHKS SLFRPDVIGP AGLTPLHIAA GKDGSEDLLD ALTDDPGKVG  840
IDAWKNARDS TGSTPEDYAR LRGHYSYIHL VQKKINKRPP SGHVVVDIPS AVSDCSTNEK  900
PNNESTSSFE IGQLELRSIK RNCKLCDQKL AYGYGTANRS LVYRPAMLSM VAVAAVCVCV  960
ALLFKSCPEV LYIFRPFRWE LLDYGTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-32147229384squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.106180.0boll| embryo| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437915.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A0D2RER50.0A0A0D2RER5_G
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12