PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G0533
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 273aa    MW: 31122.6 Da    PI: 10.3165
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G0533genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57376.25.8e-2457149297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  +fqr+wse Dei +Lq+l+     +  s  +d+  fy+ +++s+s  ++ksql+eK+rrL+kKf+  +++ ++g +ps  + hd+  f+lsk++W 
  Gh_D12G0533  57 KFQRIWSEPDEIRFLQALLRS---HHLSFPKDLPLFYSSFSHSMSQPYTKSQLSEKLRRLRKKFRVVSSRLARGLNPSSLSLHDRALFDLSKRLWS 149
                  79*****************87...5567788****************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.3E-2758149IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDSSQPHPSK PSASKLPIKR KSPHHPQFFT PKLEYQPIIL PPPKPKPKPQ PQTPPFKFQR  60
IWSEPDEIRF LQALLRSHHL SFPKDLPLFY SSFSHSMSQP YTKSQLSEKL RRLRKKFRVV  120
SSRLARGLNP SSLSLHDRAL FDLSKRLWSP EFASSSPFGK NSSGFNGVAG NGFDDCDTID  180
DDGEVKINGV SLHYDFAAGR DEVISGETID GVLAKSVLNA FDECIKEVRV MFTKQGVVCM  240
DTTERKWKEQ RVSEFDVLGR RLRLVIENSL TRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.30570.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5780580.0JX578058.1 Gossypium hirsutum clone NBRI_GE9999 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436763.10.0PREDICTED: sorbin and SH3 domain-containing protein 2-like
TrEMBLA0A0D2SVN70.0A0A0D2SVN7_G
STRINGSolyc05g051330.1.11e-61(Solanum lycopersicum)
STRINGPGSC0003DMT4000968752e-61(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1804289