PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G3165
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 347aa    MW: 38083.4 Da    PI: 8.9454
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G3165genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.1e-4175151177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +CqvegCe+dls++k y+ rhkvC  hsk+p+++v+g+eqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk++
  Gh_D11G3165  75 RCQVEGCEVDLSDVKAYYARHKVCVSHSKSPKAIVAGIEQRFCQQCSRFHQLPEFDKAKRSCRRRLAGHNERRRKQS 151
                  6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-3370137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.47973150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.32E-3974154IPR004333Transcription factor, SBP-box
PfamPF031104.4E-3176149IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MEMGSSSLSD SGGSSIDSLN NNALKLGRNI YFNDSSAAVN GGPATMKTQS PPTQPPLGCK  60
KPRVGGMIHG GRPPRCQVEG CEVDLSDVKA YYARHKVCVS HSKSPKAIVA GIEQRFCQQC  120
SRFHQLPEFD KAKRSCRRRL AGHNERRRKQ SPGSLFPSHY SRLSSSVIES NGRGRSFILD  180
FTAYSRVSGK DAWPTMRSLD RIPGNQNTAP EKSLQHHHPW PKNMENPSSG DLFLQGSLGG  240
TGFSGTATSQ GECFTGVSDS SCALSLLSNQ PWGSKNRASA LGVNDMMNTE PMPHDTFVNP  300
YLQTSEPADA QHFGRLELPQ QNSVQHMELE QHSRSYDTSA QYIHWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-29761491184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.256490.0ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223230.0KJ622323.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434994.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotA3C0579e-60SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A0D2SWB20.0A0A0D2SWB2_G
STRINGVIT_08s0007g06270.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.14e-55squamosa promoter binding protein-like 9