PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G2965
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 317aa    MW: 34075 Da    PI: 8.2219
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G2965genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822201.13.4e-6221191118
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kple+++++g sa+asp+ss++ s+
  Gh_D11G2965   2 TSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPLERMDIVGGSATASPSSSYHPSP 99 
                  5899*****************************************************************************************99888 PP

       DUF822  99 kssalaspvesysaspksss 118
                   ss+++s ++s+  + ++ +
  Gh_D11G2965 100 MSSSFPSSASSSYVVNSNGD 119
                  88888777766555444333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.4E-563131IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RKGCKPLERM DIVGGSATAS PSSSYHPSPM SSSFPSSASS SYVVNSNGDG  120
SSLIPWLKNL SSASSSPMSS KLPHIYIHSG SISAPVTPPL SSPTARTPRT NTDWEDLTAR  180
PGWSAQQHSF LPSSTPPSPG RQIVPDPEWF AGLRIPLSGP TSPTFSLVSS NPFGFKEEVL  240
AGGGSRMWTP GQSGTCSPAI AAGSDHTADV PMSEVISDEF AFGSNATGLV KPWEGERIHE  300
DCGSDDLELT LGSSRTR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.200030.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434546.10.0PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-136BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A0D2SUL40.0A0A0D2SUL4_G
STRINGVIT_19s0014g00870.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-119BES1/BZR1 homolog 4