PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G2023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 366aa    MW: 39938.8 Da    PI: 5.6235
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G2023genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573134.73.3e-42146241297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  lfqrl+se+Dei+lL+G++d+ aktg++p+ d+++fy+fvkksi+ +vsk ql++K+rrLKkKfk++v k k+g++p+fsk+h+qk+felskkiWg
  Gh_D10G2023 146 LFQRLFSEDDEIALLKGMLDYSAKTGADPHTDMNGFYDFVKKSIHTNVSKVQLMDKVRRLKKKFKNNVGKNKKGEDPTFSKAHEQKAFELSKKIWG 241
                  69*********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-36147241IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MAPKHANPVE VPAPAFSSEE DEEVTSSEEE EEGSSTEEEG EEDPKTKSTP LTHKIPPHRK  60
LETANDESDE SGSDSESESD TAAPVAIATK PGSNKPLASS SKRPGESGLD AKEGKRPKKK  120
VGGEGMATAP VVEEVKRTGE DAKKLLFQRL FSEDDEIALL KGMLDYSAKT GADPHTDMNG  180
FYDFVKKSIH TNVSKVQLMD KVRRLKKKFK NNVGKNKKGE DPTFSKAHEQ KAFELSKKIW  240
GVSGKVESST AKSNGKAKGN NKVVAALKAE LPSSSDKKTD NAVPIEVDIV VSKSYSSLLD  300
MKFSVSDTEV GVVKVGLDMV DGEKKAALEA KWRKLQMAQL ELFVERAEFV TEQAKLALKY  360
YKSEDE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454073.10.0PREDICTED: mediator-associated protein 1-like
RefseqXP_012454074.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D2TC680.0A0A0D2TC68_G
STRINGPOPTR_0001s30110.11e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.15e-30DNA-binding storekeeper protein-related transcriptional regulator