PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G1634
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 793aa    MW: 89616.2 Da    PI: 6.5068
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G1634genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.82.3e-36136211176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +Cqv+gCe+d+se+k yhrrh++C  ++++++vl++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn rrr+k
  Gh_D10G1634 136 RCQVPGCEVDISELKGYHRRHRICLRCANSSTVLIDGETKRYCQQCGKFHLLSDFDEGKRSCRRKLERHNIRRRRK 211
                  6**********************************************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-28131198IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.325134211IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-32135213IPR004333Transcription factor, SBP-box
PfamPF031102.2E-27137211IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MDQDPSPATQ TPRGDHRSEN RKMDFPVTGP ELASSVWDWN DLLELTSDDH LPISFDDYGF  60
SPPPLEVLAG DPNTVPAPDR VRKRDPRMTC SNFIAGRVPC ACPEIDAQVE KLEEEEAGAP  120
GKKRARTGRV GSGTCRCQVP GCEVDISELK GYHRRHRICL RCANSSTVLI DGETKRYCQQ  180
CGKFHLLSDF DEGKRSCRRK LERHNIRRRR KIVGSKTAVN KESQGAIQSD GIACDGEAGK  240
DDLSGLIAEE EPAFESEEAL VSAHCSAPLL QDIRNDSVVT LIDTETDGGK DDSKFSNSTS  300
YCDSKTAYSS MCPTGRISFK LYDWNPAEFP RRLRHQIFEW LANMPVELEG YIRPGCTILT  360
VFISMPNNMW AKLSENPMTY MHDFVFRPGR MLYGRGFMTI YLNNMIFHTR KDGTSMVKID  420
PEVQVPRLHF VYPACFEAGK PMEFVACGSN LLQPKFRFLV SFAGRYLPCY YRVASSLVQS  480
KDDSPSCDHQ LYKIYIPQTE PDLFGPAFIE VENQSGLSNF IPVLIGDKEV CSEMKSIQQR  540
FDASVFQERS IFSTTGSLFE ACEMSTSQHR AYSEFLLDIA WLLREPKLEN FKETIASSQI  600
LRFNRLLSFL IQNESTIILK KILQNLKIVV EMIGFDGTND SGVRLLQKYM NHARDILSDE  660
LQKGEIPVFR SEYIEQERNQ VSQSSFDNNE LPIVPKISQV LEERTSKLQT IMAAPTPSET  720
VPLLNKENIM NVNLSKDYSR KSCGFATMRL RSHAAVLIIA ATAICLGMCA VIFHPNRVGE  780
FAVTMRRCLF DRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A7e-41136213582squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197209RRKLERHNIRRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.250980.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223150.0KJ622315.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455434.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X2
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A0D2VNV10.0A0A0D2VNV1_G
STRINGVIT_05s0020g02160.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63582644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.20.0squamosa promoter binding protein-like 7