PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G1574
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 393aa    MW: 42852.2 Da    PI: 9.4152
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G1574genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.52.2e-151152344
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 i n++ r v++ kRr g+ KK  EL +LC++e++++i+s++ 
  Gh_D10G1574 11 IANNTSRRVSLKKRRLGLVKKVMELTTLCGIEACLVIYSPDE 52
                 899************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.142149IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-21160IPR002100Transcription factor, MADS-box
CDDcd002665.49E-30285No hitNo description
SuperFamilySSF554559.94E-23293IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-141152IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MTRKKVKLAW IANNTSRRVS LKKRRLGLVK KVMELTTLCG IEACLVIYSP DEQEPVVWPS  60
QEEARRLIKK FYQVPEIELI KKMMNLETYI KEKVFVLQDQ LKKMNRKNMK VEVRQLMLQI  120
EQGKMVDEFN VNELDCLIWY METMRIATRK HTEYYQPVPF SSAASIQGVD PLPPPAQGPT  180
IGDQIGNANA MIRSGASSKI SRFHVEGIPG LPYSSAGDSS LASHLWVLEP SYGASSSVVA  240
EQGMPRPPFG VGSSSNVVAN GLGLPRPPFS KGNSSNVAAY VLGLPGPLAG EGSSSNVVVD  300
HSGLPMPSFG EGSSLNVASD HLGLPRLPFG EGRSSNIVVD HLGLPRPPFG EGSSSNVVVD  360
HLGLQRPPFG SSSSSSSFDI LKNLSKQDVH INF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAWIANNTSRRVSLKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016718734.10.0PREDICTED: uncharacterized protein LOC107931364
TrEMBLA0A1U8LZM70.0A0A1U8LZM7_GOSHI; uncharacterized protein LOC107931364
STRINGGorai.011G177600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.12e-24AGAMOUS-like 48