PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G0922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 304aa    MW: 33194.3 Da    PI: 7.3705
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G0922genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.45.8e-4471061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvhk+FGasnv kll++l++++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l+ +k
  Gh_D10G0922   7 PCAACKFLRRKCTQECVFAPYFPPDNPQKFANVHKVFGASNVAKLLNELNTSQREDAVNSLAYEAEARLRDPVYGCVGLISILQHKLKQMQHDLNNAK 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_D10G0922 105 KE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0876107IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-437104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DNPQKFANVH KVFGASNVAK LLNELNTSQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HKLKQMQHDL NNAKKELSTY IGPQAMLPIL  120
QPSVFLQQHV GNPSSSSSSS AVMQHNMMPM MGIPTAAAAA SGQLVLREPQ QQQIFEAQQQ  180
LAAVIAAREQ QEMFRGYEQH HGGQQPEIVR FNNGFDGSAS VTATGFNQIT TAAAAATMSP  240
SLALGSFENP YQIQAQQDHH HCHGGHHPLQ AQLLLQPQQG QPQNQQQQPQ RSGSEEARSI  300
GPSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-5141248129LOB family transfactor Ramosa2.1
5ly0_B8e-5141248129LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}.
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454227.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_012454228.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_012454230.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-96LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0D2T5X90.0A0A0D2T5X9_GOSRA; Uncharacterized protein
STRINGGorai.011G104600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-92ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]