PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G0318
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 319aa    MW: 34336.4 Da    PI: 9.0617
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G0318genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822203.56.3e-6321261125
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp ++++++g sasasp+ss++ s+
  Gh_D10G0318   2 TSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPVDRMDIMGGSASASPCSSYHPSP 99 
                  5899*******************************************************************************************888 PP

       DUF822  99 kssalaspvesysaspksssfpspssl 125
                   ss+++sp++s  +  ++ +  ++s +
  Gh_D10G0318 100 GSSSFPSPASSHYTANANGNADANSLI 126
                  888888888777666666555555444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.5E-603133IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPVDRM DIMGGSASAS PCSSYHPSPG SSSFPSPASS HYTANANGNA  120
DANSLIPWLK NLSSGSSSAS SKLAHHLFIA GGSISAPVTP PLSSPTSRTP RTRSDWDEMN  180
AGPTCTGKRF SYLPASTPPS PSRQVFPDPG WLSRLEIPQS GPTSPTFSLV SRNPFGFKDE  240
ALSRGGSRMW TPGQSGTCSP AFPAGVDQTS DVPMSDAIAA EFAFGSNMTG LVKPWEGEKI  300
HEECVANDLE LTLGNSKTR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80071e-175boll| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012456862.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1
RefseqXP_012456863.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2
SwissprotQ9ZV881e-131BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A0B0PF600.0A0A0B0PF60_G
STRINGPOPTR_0004s06100.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-106BES1/BZR1 homolog 4