PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G0285
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 160aa    MW: 17794 Da    PI: 5.2177
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G0285genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.42.4e-43101091100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++p+ +reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el++++
  Gh_D09G0285  10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVPTFQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVITLQRELDATN 107
                  7*********************************************************************************************9987 PP

       DUF260  99 ee 100
                  ++
  Gh_D09G0285 108 AN 109
                  65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1069110IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MSSSSYSSSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVPT  60
FQREDAVNSL AYEAEARLKD PVYGCVGAIS VLQRQVITLQ RELDATNANL FRYAYNEMPP  120
LRPPQPPPPS AAGQSSAFCY PYQWNDPSDE DNERSSGGNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-6371188119LOB family transfactor Ramosa2.1
5ly0_B6e-6371188119LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016673493.11e-116PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q32e-64LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A1U8IB341e-115A0A1U8IB34_GOSHI; LOB domain-containing protein 25-like
TrEMBLA0A2P5SBW31e-115A0A2P5SBW3_GOSBA; Uncharacterized protein
STRINGGorai.006G033100.11e-115(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.14e-64LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]