PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G2099
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 614aa    MW: 69713.8 Da    PI: 5.5897
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G2099genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN35122.8e-156484201353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmw+d+m+lkr+ke++k     ke  ++ +k++ s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+k
  Gh_D08G2099  48 DELERRMWRDKMRLKRIKEQNKC----KEG-IDIAKQRLSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDK 140
                  79*************99999996....788.******************************************************************* PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyqa+n i+++++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww++lgl++dqg+ppyk
  Gh_D08G2099 141 VRFDRNGPAAIAKYQADNSIPGKNDGCNS-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGNEEWWPQLGLPEDQGPPPYK 237
                  ***************************88.9******************************************************************* PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXX.XXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedve.gkkes 290
                  kphdlkkawkv+vLtavikh+sp+i++ir+l+rqsk+lqdkm+akes ++l+++nqee+++++++++s    s+  ++ ++++++ +++dve +++e+
  Gh_D08G2099 238 KPHDLKKAWKVGVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESSTWLAIINQEEALARELYPDSCpplSSGGGNVSLVINDCSEYDVEgVEDEP 335
                  *******************************************************************444456666999*************555555 PP

                  X.XXXXXXXXXX..........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 291 kikhvqavktta..........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  +  +vq++k ++                          +++++rkrk ++ + ++v++k  ++tc+  q+++ e +l+f+d++++++++
  Gh_D08G2099 336 N-FDVQERKPRTissnlvmermraiqqppysikgevvsNLDFTRKRK-PSNDLNMVEQK--IYTCEFLQCPYGEFRLGFHDRTARDNHQ 420
                  5.99*****9999******************************9998.56666666555..6*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.5E-13048295No hitNo description
Gene3DG3DSA:1.10.3180.102.4E-76168305IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.53E-62174298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MMMFDEMGIC GDMDFFSAPL GEKDVAASQI EPEATVEDDY SDEEIDVDEL ERRMWRDKMR  60
LKRIKEQNKC KEGIDIAKQR LSQEQARRKK MSRAQDGILK YMLKMMEVCK AQGFVYGIIP  120
EKGKPVTGAS DNLREWWKDK VRFDRNGPAA IAKYQADNSI PGKNDGCNSI GPTPHTLQEL  180
QDTTLGSLLS ALMQHCDPPQ RRFPLEKGVP PPWWPTGNEE WWPQLGLPED QGPPPYKKPH  240
DLKKAWKVGV LTAVIKHISP DIAKIRKLVR QSKCLQDKMT AKESSTWLAI INQEEALARE  300
LYPDSCPPLS SGGGNVSLVI NDCSEYDVEG VEDEPNFDVQ ERKPRTISSN LVMERMRAIQ  360
QPPYSIKGEV VSNLDFTRKR KPSNDLNMVE QKIYTCEFLQ CPYGEFRLGF HDRTARDNHQ  420
LTCPYRNSSA QFGGSNFNVN EVKPVIFPRQ FGQSKPAAPQ VTSVSTPFDL SGLGVPEDGQ  480
KTIGELMSVY DNNIQGNKNM NPSNNLVTKG QNVLQPKIQH QQDEFFRGQG VMMEGNFFED  540
SSMLHNHQMF SQGEAQFERF KGLNSPLDSN HNNNNSFQLM FGSSFDLASF DYKEDLHAVG  600
MDSMPKQDVS IWFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-851733052134Protein ETHYLENE INSENSITIVE 3
4zds_B5e-851733052134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5253170.0HQ525317.1 Gossypium herbaceum clone NBRI_B2_520 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476375.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0D2R9630.0A0A0D2R963_G
STRINGPOPTR_0004s20830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein