PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1686
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 373aa    MW: 41819.7 Da    PI: 8.8911
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1686genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32193246255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gh_D08G1686 193 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 246
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15190246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28191246IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23193246IPR006447Myb domain, plants
PfamPF002492.4E-7194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PTSRGLDSRS SMSSMAKPDN CFELSFSNPR VSDSNSNHFH  60
QLLQNGSATA NCNGNLFQSY HHNQFPHHHN QLQHPLLYQH QHHHQQHQQG LGQEFGFLRP  120
IRGIPVYQNP PPPPPSPPFP FAQQPLDSSL PSSPSYLATT KIGNTSLNPF QSQGLMRSRF  180
MSRFPAKRSM RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH  240
LQMYRTVKTT DRAAASSAGQ MDAFENGSSG DTSEDMMFEI QNPRRSEISV QQGRSSSSNA  300
HQDKEYHGLW SNSSREAWLH GKPNDSPLNL PSLQKDMDPK CLSYERISDV SSSSLSETCS  360
KKPNLEFTLG VPH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.217311e-116boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475654.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6163e-82KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0B0MP710.0A0A0B0MP71_G
STRINGPOPTR_0001s02010.11e-172(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-73G2-like family protein