PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 283aa    MW: 31168.7 Da    PI: 9.0188
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1595genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.29.8e-32155211158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep+YVNaKQy++Il+RRq Rak+e ekk  +k rkpylheSRh hA+rR+Rg+gGrF
  Gh_D08G1595 155 EEPVYVNAKQYHGILRRRQIRAKAELEKKA-IKIRKPYLHESRHLHAMRRARGCGGRF 211
                  69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.6E-36153214IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.803154214IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.0E-26156211IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.3E-24157179IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860159179IPR018362CCAAT-binding factor, conserved site
PRINTSPR006169.3E-24188211IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MPAKPGNDDQ QIDRGAQSVL QSTAYSEPWW KGVGTNPFGE AASKSPSVEQ LNGSVANGDV  60
HSQAHGDLGN EDGRNRQDRQ HLKHVPSTTP LTLGEHHEPN SQMELVGHSI VLTSYPYSDP  120
QYGGMLTSYG PQMMVSPHLY GMHQARMPLP LQMEEEPVYV NAKQYHGILR RRQIRAKAEL  180
EKKAIKIRKP YLHESRHLHA MRRARGCGGR FLNTKKQGDD VTSPTSQKGM NSDENISTKS  240
SRSECVSANG AGNMNSFYGQ QEGNCARDIM QGNGAQHGAP SIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-19155217264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.7130.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475444.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_012475443.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_012475442.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLA0A0D2PDJ80.0A0A0D2PDJ8_G
STRINGPOPTR_0009s06540.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM160191014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.45e-42nuclear factor Y, subunit A1