PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 167aa    MW: 18749.6 Da    PI: 7.9919
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1390genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.52.5e-3917115199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaC++lrr+C ++C+lapyfp ++p kfa vhk+FGasnv+kl++ ++e++reda+++lvyeA+ar+rdPvyG++g+i++lq+ ++ lk +l++++
  Gh_D08G1390  17 PCAACRMLRRRCDSNCILAPYFPGDEPDKFAGVHKVFGASNVIKLIQMVEETNREDAVKALVYEARARLRDPVYGSTGTIFQLQRMVQDLKLQLKSTN 114
                  7******************************************************************************************9999877 PP

       DUF260  99 e 99 
                  +
  Gh_D08G1390 115 A 115
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.56716117IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3917114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MGSQTLARLG IRTHHQPCAA CRMLRRRCDS NCILAPYFPG DEPDKFAGVH KVFGASNVIK  60
LIQMVEETNR EDAVKALVYE ARARLRDPVY GSTGTIFQLQ RMVQDLKLQL KSTNARVLEL  120
QQQKDQLLGI FMNVDHLDVL SSVDHGPSFS LDYEDSLASN LLIGKPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-361711811112LOB family transfactor Ramosa2.1
5ly0_B1e-361711811112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477966.11e-122PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-43LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0D2MYN21e-120A0A0D2MYN2_GOSRA; Uncharacterized protein
STRINGGorai.004G151300.11e-121(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2496034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-45LOB domain-containing protein 1