PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G0122
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 203aa    MW: 22075.1 Da    PI: 5.6779
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G0122genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.87.5e-43371361100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+Ca++C+lapyfp ++p+kf n+h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  Gh_D08G0122  37 PCAGCKILRRRCADKCMLAPYFPPTEPAKFTNAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQLAKAQ 134
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Gh_D08G0122 135 AE 136
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.01136137IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-4337134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MFKMEFREPT PSAVASPNSS NPSSPSTPTS PPVVISPCAG CKILRRRCAD KCMLAPYFPP  60
TEPAKFTNAH RVFGASNIIK FLQELPESQR ADAVSSMVYE ASARIRDPVY GCAGAICQLQ  120
KQVNELQAQL AKAQAEVVNM QLQQANLVGA LLCMEATAPP PQPHPQQLAV DTFMCSPQSY  180
HSNPGFIDDD ENNNNLGSLW EPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-42231391113LOB family transfactor Ramosa2.1
5ly0_B1e-42231391113LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.256850.0boll
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017625407.11e-117PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK085e-73LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A2P5QBH01e-143A0A2P5QBH0_GOSBA; Uncharacterized protein
STRINGGorai.004G012800.11e-114(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-62LOB domain-containing protein 1