PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G2390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 300aa    MW: 33785 Da    PI: 9.0838
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G2390genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.14.6e-31163219158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  dep+YVN+KQy++Il+RR +Rakle ++kl  ksrkpylheSRh hA++R RgsgGrF
  Gh_D07G2390 163 DEPIYVNPKQYHGILRRRRHRAKLETRNKL-VKSRKPYLHESRHFHAMNRIRGSGGRF 219
                  79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.1E-34161222IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.202162222IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.6E-27164219IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.5E-22165187IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.5E-22196219IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MASRVRILPK ENLLISCPPW WNSNEQQFVE IVPQNVSLKK AENHSQLYHN AKRFDLQLLD  60
HEPTLAEAGV TGVNNSQCNS SESGQVESCR KDIEGQTKPV YLLNNPNTLL SPSHPNYNHS  120
MACAQYPYTD AYFTGLFTPY GQQTIMTGTA PTRIPLPLDL AEDEPIYVNP KQYHGILRRR  180
RHRAKLETRN KLVKSRKPYL HESRHFHAMN RIRGSGGRFL SKKKPQRSDP TSIYISDIGC  240
LDQKDNNRSE LESRCSHTAE YGGSCTSCSH ISSITNNGGD ISRRAVSSCN GIQNCASLVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-20163233275NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479556.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X2
TrEMBLA0A0D2PK970.0A0A0D2PK97_G
STRINGPOPTR_0006s14740.17e-79(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2438834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.11e-37nuclear factor Y, subunit A7