PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G1868
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family FAR1
Protein Properties Length: 659aa    MW: 74599.1 Da    PI: 6.036
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G1868genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR180.92.2e-2584169291
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                  fY+eYA++vGF +++ +s++skr+g++++ +  Cs+ g+++e++++     ++r+  +tgCka++++k+++++kw+++++++eHnHe++p
  Gh_D07G1868  84 FYREYARSVGFGITIVSSRRSKRSGKFIDVKVACSRFGSKRESNTT----LNPRSCPKTGCKARMHIKRRQNEKWVIHSFVKEHNHEICP 169
                  9***************************************998777....99***********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.2E-2384169IPR004330FAR1 DNA binding domain
PROSITE profilePS509668.753355391IPR007527Zinc finger, SWIM-type
PfamPF044341.3E-6356389IPR007527Zinc finger, SWIM-type
SMARTSM005751.0E-5366393IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MEIDLEVPSK EQEKLIPGSD ENSDVLDAAE EIDEEDNMEL LQASFTGCED NVDVTTVEAN  60
VHEGAIFEPQ NGLEFESKET AYAFYREYAR SVGFGITIVS SRRSKRSGKF IDVKVACSRF  120
GSKRESNTTL NPRSCPKTGC KARMHIKRRQ NEKWVIHSFV KEHNHEICPD DFYYAIRGRS  180
KQPGAVSCQK KGLQLVLDEK DVELMLDFFM CMKDENPGSF YAIDFDNEKC ARSVFWVDAK  240
AGISTTIRSE SVASFFDKFM HKAATFGEFI EQLKSFSLEL YEMEAKADFE TQSKQPELRS  300
VSAFEKQMSM IYTDTVFKKF QAEILGIVSC HLQKESEDED NVVFRVDDFE ERQNFLVAWS  360
KREFDICCLC RSFEYKGFLC KHSLLVLQMS GVSDIPCHYI LKRWTQEVKI RQTLGEKSNR  420
LHYRVQRFND LCKRAIKLGE EGSLSQEAYT IALQALEKAL KNCVSLNNTG KGVCEPSTSS  480
VHGLLETDAE NYWNATTKLS KKKKACKKRK VHFDSEGVSM GQDSCQQMTS SRANALDGCS  540
VSQQDMHGMD VSSRAPTLDG CYGAQQNIQG MGQLNSISPF RGGYYSNQQN LLGLGQLHSL  600
AASDNHYGNQ QNMQGHLPFR APAMQGFDIQ EGLQDEERPL DSTHFLGIAS KHLHDKLLS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489038.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 2
RefseqXP_012489046.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 2
TrEMBLA0A0D2M1D90.0A0A0D2M1D9_G
STRINGVIT_03s0017g01830.t011e-175(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.15e-93FAR1 family protein