PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G1151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 203aa    MW: 22201.2 Da    PI: 6.7359
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G1151genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.16.3e-43411401100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  Gh_D07G1151  41 PCAACKILRRRCADKCVLAPYFPPTEPTKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCTGAICQLQKQVNELQAQLAKAQ 138
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_D07G1151 139 AE 140
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.14340141IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-4341138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MLKMEYTSEV AAQSPSPKSS NSSSSPPPPP PLPSTSVVIS PCAACKILRR RCADKCVLAP  60
YFPPTEPTKF TIAHRVFGAS NIIKFLQELP ESQRADAVSS MVYEASARIR DPVYGCTGAI  120
CQLQKQVNEL QAQLAKAQAE VVNMQLQQAN LVALLCMEVA QSPQQNPHQP INDFLSNSPQ  180
SYHSNPSFLD DNNLGSSWEP LWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-43331433113LOB family transfactor Ramosa2.1
5ly0_B5e-43331433113LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6158951e-142JX615895.1 Gossypium hirsutum clone NBRI_GE60161 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016745238.11e-148PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1U8P4H71e-146A0A1U8P4H7_GOSHI; LOB domain-containing protein 1-like
STRINGGorai.001G129700.11e-123(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-64LOB domain-containing protein 1