PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0068
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 620aa    MW: 66549.5 Da    PI: 8.0321
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0068genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.23.9e-14122160241
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                  ++k+CnCk+s+Clk+YCeCfa+g++C+  C+C +C N+ +
  Gh_D07G0068 122 KQKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCYNNVD 160
                  89**************************.********986 PP

2TCR50.83.3e-16206245140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Gh_D07G0068 206 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 245
                  589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-15121161IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.939122246IPR005172CRC domain
PfamPF036388.9E-11123158IPR005172CRC domain
SMARTSM011148.4E-20206247IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12209244IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MGKEEGGGEI PPKMVQSDTA DFPSKKLARQ LDFTAGFGGV SSGSVNLPEH PQSTQRIGVA  60
SPSAAVTVQQ QQIKPPTVEA AAVPVVAAQH PPLTTASTRV VKPESPKAKP RPNELKDGTP  120
KKQKQCNCKH SRCLKLYCEC FASGTYCDGC NCVNCYNNVD NEAARRDAIE ATLERNPNAF  180
RPKIASSPHG ARDSREEAGE VLMLAKHNKG CHCKKSGCLK KYCECFQANI LCSENCKCMD  240
CKNFEGSEER QALFHGDHAN NMAYIQQAAN AAITGAIGSS GYASTPVSKK RKGQELFFGS  300
TAKDPSVHRL GNFPQHHHIR ASAPASSLSS VPASRAGTTA AVGPSKFTYR SLLADIIQKQ  360
DLKELCSVLV VLSGEVAKTL SDQRILTDKR AEDHAETSIA PSTQDRLQNQ KDSDAEKTTA  420
DDCSSANQAD KAGPEESSSD GADMPKGRPM SPGTLALMCD EQDTMFMASA SPNRIMGHGC  480
STSSQLPYEQ GMTEIYAEQE RIVLTKFRDC LNRLITFGEI KETQCSSLAR TEIGSQRVHP  540
SNGTETVRTE TRNQQGSTTN GVAKNASPPT VKTSPMTASV ITASNNDLPR GPSHPENGDA  600
KSKSEKTDVK TINAADNRPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-321142552132Protein lin-54 homolog
5fd3_B3e-321142552132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468645.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0D2PJZ20.0A0A0D2PJZ2_GOSRA; Uncharacterized protein
STRINGGorai.001G006500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein