PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G2134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 322aa    MW: 34614.3 Da    PI: 7.764
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G2134genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822208.61.7e-6421471150
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc eAGw+ve+DG ty+kg+kp +++++ g sasasp+ss++   
  Gh_D06G2134   2 TSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAGWTVEEDGSTYKKGCKPVDRMDILGGSASASPCSSYH--- 96 
                  5899*******************************************************************************************... PP

       DUF822  99 kssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvsssl 150
                       +sp++sy++sp sssfpsp+s+    + +     +sl+p+l++ls+ sss+
  Gh_D06G2134  97 -----PSPCASYNPSPGSSSFPSPASSHYRANGNGnadaNSLIPWLKNLSSGSSSA 147
                  .....******************9987665444335677**********9977664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.6E-653141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCDEAG  60
WTVEEDGSTY KKGCKPVDRM DILGGSASAS PCSSYHPSPC ASYNPSPGSS SFPSPASSHY  120
RANGNGNADA NSLIPWLKNL SSGSSSASSK LAHHLYFAGG SISAPVTPPL SSPTSRTPRT  180
RNDWDETTGG SARTGQRHCY LPSSTPPSPN HQVFPDPEWL SSGPTSPTFS LVSRNPFGFK  240
DEALSAGGSR MWTPGQSGTC SPAFPAGVDQ TSDVPMSDVI AAEFAFGSNF TGLVKPWEGE  300
MIHEECVADD DLELTLGNSK TR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.21380.0boll| ovule| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO783472510.0
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449695.10.0PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-131BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A0D2UJY70.0A0A0D2UJY7_G
STRINGPOPTR_0004s06100.11e-148(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-107BES1/BZR1 homolog 4