PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G1825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 127aa    MW: 13941.8 Da    PI: 9.4234
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G1825genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26098.47.2e-3151121171
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearard 71 
                  +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k l++lpe++r da+ss+vyeA ar+rd
  Gh_D06G1825  51 PCAACKILRRRCVEKCVLAPYFPPTEPYKFTIAHRVFGASNIIKSLQELPESQRADAVSSMVYEASARIRD 121
                  7********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.64750127IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-3051121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MEHNEKCAQS QSCSSSPRFP SPNSQSPPPP PPPPASPSLP PPPTPTVVLS PCAACKILRR  60
RCVEKCVLAP YFPPTEPYKF TIAHRVFGAS NIIKSLQELP ESQRADAVSS MVYEASARIR  120
DXRRIKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-28501211081LOB family transfactor Ramosa2.1
5ly0_B1e-28501211081LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.135790.0ovule| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016671354.16e-81PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-44LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK082e-43LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A1U8I6J41e-79A0A1U8I6J4_GOSHI; LOB domain-containing protein 1-like
TrEMBLA0A2P5QIB71e-79A0A2P5QIB7_GOSBA; Uncharacterized protein
STRINGGorai.010G203800.12e-78(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-46LOB domain-containing protein 1