PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G1413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family VOZ
Protein Properties Length: 480aa    MW: 53418.1 Da    PI: 6.103
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G1413genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ415.87.5e-1282084221215
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  p+psaflgpkcalwdc+rpaqg   + dycssfha+la+neg+pg+ pvlrp+gi+lkdgllfaalsak+qgk+vgipec+gaatakspwna+elfdl
  Gh_D06G1413 208 PSPSAFLGPKCALWDCPRPAQGLGGCLDYCSSFHAALAMNEGPPGMGPVLRPGGIGLKDGLLFAALSAKTQGKDVGIPECQGAATAKSPWNAPELFDL 305
                  89************************************************************************************************ PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksa 196
                   +l+ge+irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelklvd+kksa
  Gh_D06G1413 306 LVLDGESIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLVDGKKSA 403
                  ************************************************************************************************** PP

          VOZ 197 kgkvskdsladlqkklgrl 215
                  kgk  kd+++   k++g+l
  Gh_D06G1413 404 KGKPVKDTVSYPHKHMGKL 422
                  *****************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MGKGSKNNCK SASHKLFKDK AKNRVDDLQG MFLDLQFARK ESRGIDVAVL EEQLHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSSDICRL LQLCEEEDDA TSILAVPKPE PNNQSLQVGD  120
TAASQERYAV NQGQHECGFP LVDQCKESPS QVCTMSINSL EGATQLEYHQ FDLDQDFEHF  180
YTGYNGTEFC REDDAMPRTY SYLPSICPSP SAFLGPKCAL WDCPRPAQGL GGCLDYCSSF  240
HAALAMNEGP PGMGPVLRPG GIGLKDGLLF AALSAKTQGK DVGIPECQGA ATAKSPWNAP  300
ELFDLLVLDG ESIREWLFFD KPRRAFESGN RKQRSLPDYN GRGWHESRKQ VMNEFGGLKR  360
SYYMDPQPLN HFEWHLYEYE INKCDACALY RLELKLVDGK KSAKGKPVKD TVSYPHKHMG  420
KLPDGFHSEN NCCVKGRTKV NAKIGVGNFF STPNAVVPTS EKFEYGPSVQ YDYVGSYYLT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.149310.0boll
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016730237.10.0PREDICTED: transcription factor VOZ1-like isoform X3
RefseqXP_016733642.10.0PREDICTED: transcription factor VOZ1-like isoform X3
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1U8MTS70.0A0A1U8MTS7_GOSHI; transcription factor VOZ1-like isoform X3
STRINGGorai.010G157200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]