PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G1178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 686aa    MW: 77587.6 Da    PI: 6.4134
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G1178genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3419.43.9e-128383991336
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmwkd+++lkr++er+k   ++++ a++++k +k+++qa+rkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++raWW+ek
  Gh_D06G1178  38 DELERRMWKDRIKLKRIRERQKI--AAQQ-ALEKQKLKKTSDQAQRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRAWWQEK 132
                  79*************88888875..4455.59****************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fd+ngpaai+kyqa++l++ ++++   ++ + ++sl++lqD+tlgSLLs+lmqhcdppqr++plek ++pPWWPtG+e+ww +lgl++ q+ ppyk
  Gh_D06G1178 133 VKFDKNGPAAIAKYQADCLAMIEADNG--RNGNLQSSLKDLQDATLGSLLSSLMQHCDPPQRKYPLEKRIPPPWWPTGNEDWWVKLGLQQGQS-PPYK 227
                  *********************999988..68999**********************************************************9.9*** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...........XXXXXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...........slrkqspkvtlsceqked 283
                  kphdlkk+wkv+vLt+vikhmsp+ ++ir+++rqsk+lqdkm+akes+++l vl  ee+++++ s+++               +++++  +s+++++d
  Gh_D06G1178 228 KPHDLKKMWKVGVLTSVIKHMSPDTAKIRRHVRQSKCLQDKMTAKESAIWLGVLACEEALIRQPSSDNGtsgvtelprlgC--SDKKQPAVSTDSDYD 323
                  *******************************************************************44456776665321..3777888899999** PP

                  XXXXXXXX.XXXXXXXXXX.......................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX CS
         EIN3 284 vegkkeskikhvqavktta.......................gfpvvrkrkkkpsesakvsskevsrtcqssqfrg 336
                  v+g ++  ++ ++++++++                        ++ + +rk++  +s+  +++    + +++++++
  Gh_D06G1178 324 VDGVDDGVVSVSSKDERRNqptdaepvayitnydfhpvqineRVAKQPRRKRPHLRSSHGHQQPLQIHGDQQSVPS 399
                  **88888878777777777888899999999999999988776666677776666666666665555555555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.6E-12238284No hitNo description
Gene3DG3DSA:1.10.3180.101.4E-68161293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.62E-59166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MAELEDIGAD ISSDIEVDDL RCQNIAEKDV SEEEIEADEL ERRMWKDRIK LKRIRERQKI  60
AAQQALEKQK LKKTSDQAQR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWQ EKVKFDKNGP AAIAKYQADC LAMIEADNGR NGNLQSSLKD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKRI PPPWWPTGNE DWWVKLGLQQ GQSPPYKKPH DLKKMWKVGV  240
LTSVIKHMSP DTAKIRRHVR QSKCLQDKMT AKESAIWLGV LACEEALIRQ PSSDNGTSGV  300
TELPRLGCSD KKQPAVSTDS DYDVDGVDDG VVSVSSKDER RNQPTDAEPV AYITNYDFHP  360
VQINERVAKQ PRRKRPHLRS SHGHQQPLQI HGDQQSVPSH GDQQPMSNHI TNYDSHPVQI  420
NERVAKQPRR KRPRLRSSHG HQQPLPIHGD QQSVLSHGDQ QPMSNHSDQQ SVPSYGDQQP  480
GPRHYEHVNA ESISTLPDIN QTDLSFMEYH MPVTEQENDA SKELRHVEDG LDVQPHLPAG  540
EYCHYPATPT ATEISTHRPM LYTLEQHELH QGAAYEFYNQ SSELRPGHDS QQTLMDMNVL  600
HVRPENGVDA SALGGNGHEI AGGELHHYVK DLLHNEQDRV VHNPFSSPTS DPSFFGGFHS  660
PFELPFDGTT SLDELLDDDL IQYFGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-701652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1429435RKRPRLR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451725.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
SwissprotO231161e-180EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0D2R7370.0A0A0D2R737_G
STRINGPOPTR_0001s05360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46582548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-152ETHYLENE-INSENSITIVE3-like 3