PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G1029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family WRKY
Protein Properties Length: 496aa    MW: 53914.5 Da    PI: 6.0158
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G1029genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.42e-25184240259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+e++++g H he
  Gh_D06G1029 184 SDGYNWRKYGQKQVKSPKGSRSYYKCTFSDCQAKK-IECSDDTGHVIEVVNKGMHSHE 240
                  8********************************98.*********************8 PP

2WRKY98.34.9e-31359415359
                  -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++++itY+g H+h+
  Gh_D06G1029 359 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTNAIIITYKGVHDHD 415
                  9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-20179242IPR003657WRKY domain
SuperFamilySSF1182908.11E-20181242IPR003657WRKY domain
SMARTSM007745.3E-24183241IPR003657WRKY domain
PROSITE profilePS5081116.57184242IPR003657WRKY domain
PfamPF031063.6E-17185239IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-31342417IPR003657WRKY domain
PROSITE profilePS5081131.904352417IPR003657WRKY domain
SuperFamilySSF1182908.5E-27353417IPR003657WRKY domain
SMARTSM007748.6E-35357416IPR003657WRKY domain
PfamPF031062.6E-23359414IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MAETESQALP TKRHHHHQND DSEGQEDDDE EEEEEDGLEN EEEEEGASRV SESQGAGAAP  60
PSDDAGWKHS QLDTLPNDDP PDGLQVNSTS ESKEGSEFKE KVNIADQEVS PSLAVLSAEA  120
PISLSQQAPT SVTQGISSAP TPTLQEQSLS DQKVNGASVP KANQQKSYNL KMVSVVPIVK  180
TPVSDGYNWR KYGQKQVKSP KGSRSYYKCT FSDCQAKKIE CSDDTGHVIE VVNKGMHSHE  240
PPRKNNFTRE SKIVSSAARA SHNIQPIRIF NDSDPSTSSK ESVPETTVNP ERKGLFSCGS  300
DGNGDVQVKE ELTSEPETKK RQAFLMKKGN TVCSDSVPKA RKKPRFVVHA AGDVGISGDG  360
YRWRKYGQKM VKGNPNPRNY YRCTSAGCPV RKHIETAVDN TNAIIITYKG VHDHDMPVPK  420
KRHGQPIAPL VAAAAPASMN NLQHKKTDGG QSQVTSTQWS VGTEGELTGE ALDLGGEKAI  480
ESARTLLSIG FEIKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-26345417274WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.96850.0ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6697680.0KF669768.1 Gossypium hirsutum WRKY transcription factor 82 (WRKY82) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449854.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595831e-134WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0D2SR030.0A0A0D2SR03_G
STRINGVIT_11s0037g00150.t011e-171(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-127WRKY DNA-binding protein 32