PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G0617
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 612aa    MW: 65701 Da    PI: 7.8111
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G0617genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.92.3e-14124163242
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                  ++k+CnCk+s+Clk+YCeCfa+g++C+  C+C +C N+ e+
  Gh_D06G0617 124 KQKQCNCKHSRCLKLYCECFASGVYCDG-CNCVNCYNNVEN 163
                  89**************************.********9875 PP

2TCR50.83.2e-16208247140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Gh_D06G0617 208 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 247
                  589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.2E-16123163IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.946124248IPR005172CRC domain
PfamPF036383.8E-11125160IPR005172CRC domain
SMARTSM011148.4E-20208249IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12211246IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MGEREGGEFP PKKVQSDTAG LPAKKLARQL DFTAGFGGGS SGGVVLPEHP QSTQEMAVAS  60
SSAVAAAVTQ QQQQQQIKPQ MVATSPVAAA QPPPFTTASS RVIKPESPKV KPRPTELKDG  120
TPKKQKQCNC KHSRCLKLYC ECFASGVYCD GCNCVNCYNN VENEAARRDA IEATLERNPN  180
AFRPKIASSP HGARDSREEA GEVLVLGKHN KGCHCKKSGC LKKYCECFQA NILCSENCKC  240
MDCKNFEGSE ERQALFHGDH ANNMAYIQQA ANAAITGAVG SSGFASIPVS KKRKGQDLFF  300
GSTAKDPSVL RLGHFPQATH IRTSAPSPSM PVSCATTTAA VGTSKFTYRS LLADIIQKQD  360
LKELCSVLVV LSGEAAKTLA DQRSLTEKQA EDQTETSLVS STQDTLQSQK DFDAEKTVAD  420
DCSSANQADK VFPEDSSSDG ADTPKESPMS PGTLALMCDE QDTMFMKAPS NGLTEHGCST  480
SSQLPYGQGM TEIYAEQERI VLTKFRDCLN RLITFGEIKG KLPSPFKTQC SSLARIEIGS  540
QRSLSNGTEV VRTESGNRQG SFTNGVPKNV SPPPIKTSQT AAVVITTANN DLQRPPSLPE  600
NGDAKLKNEK QM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-321162572132Protein lin-54 homolog
5fd3_B2e-321162572132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016682666.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X2
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A1U8IX680.0A0A1U8IX68_GOSHI; protein tesmin/TSO1-like CXC 5 isoform X2
STRINGGorai.010G073200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein