PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 228aa    MW: 24791.4 Da    PI: 8.5579
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2664genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.6e-42491481100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael++++
  Gh_D05G2664  49 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAELNAVR 146
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Gh_D05G2664 147 AE 148
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81348149IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4249146IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MPECPEKGKK ERFDEIGKKI KREADVSANY QMGRRHMLGP PGTLNTITPC AACKLLRRRC  60
AQECPFSPYF SPHEPQKFAS VHKVFGASNV SKMLMEVPES QRADAANSLV YEANVRLRDP  120
VYGCMGAISA LQQQVQSLQA ELNAVRAEII KYKCREANLV PPSSHVAMLS SGAVSVAAPP  180
PATTQPPPPP PPPPLPTTTA VTTCSIYTQP NTSTDYTTLS NDNVSYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-47411613123LOB family transfactor Ramosa2.1
5ly0_B3e-47411613123LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448054.11e-161PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T52e-84LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0D2SA421e-167A0A0D2SA42_GOSRA; Uncharacterized protein
STRINGGorai.009G295000.11e-168(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-85LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]