PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 196aa    MW: 21297.3 Da    PI: 7.7078
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2414genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.51.3e-4421119199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el++++
  Gh_D05G2414  21 PCAACKLLRRKCMPGCIFAPYFPPEEPQKFVNVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAITFLQRQVQRLQKELDAAN 118
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  Gh_D05G2414 119 A 119
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.65420121IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4321118IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MVVAIVCIAV KMASSSSYNS PCAACKLLRR KCMPGCIFAP YFPPEEPQKF VNVHKIFGAS  60
NVTKLLNELL PHQREDAVNS LAYEAEARVR DPVYGCVGAI TFLQRQVQRL QKELDAANAD  120
LIRYACNDIP TGLPQVTGTS SVQPPLTPRN RLAEFNRRVG NEGGGFYQLP GALPYSFPWN  180
DASSGDMNDG GGEGGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-692013810131LOB family transfactor Ramosa2.1
5ly0_B2e-692013810131LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016748663.11e-137PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_016748664.11e-137PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML41e-74LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A2P5WNI81e-144A0A2P5WNI8_GOSBA; Uncharacterized protein
STRINGEOY208511e-116(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-76LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]