PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2053
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 154aa    MW: 16675.7 Da    PI: 8.1266
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2053genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26065.41.4e-204289148
       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllka 48
                 +CaaCk+lrr+Ca++Cvlapyfp ++p+kfa++h +FGasn++k+l+ 
  Gh_D05G2053 42 PCAACKILRRRCADKCVLAPYFPPTEPAKFAIAHLVFGASNIIKFLQV 89
                 7********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.59341146IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-194290IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MEYSEPIPTP TSSSPSLSPN SSISSNSPPS PPLSLPLVVI SPCAACKILR RRCADKCVLA  60
PYFPPTEPAK FAIAHLVFGA SNIIKFLQVV LWSFLQLNNI PCHVLSLLEM IIRLILFATV  120
STAQLSLPLL LISPAENQLT SVVEKKPHCT DSLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-1641871056LOB family transfactor Ramosa2.1
5ly0_B3e-1641871056LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6169072e-45JX616907.1 Gossypium hirsutum clone NBRI_GE61864 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462233.19e-32PREDICTED: LOB domain-containing protein 1-like
RefseqXP_017619062.11e-31PREDICTED: LOB domain-containing protein 1-like
TrEMBLA0A0D2W0R85e-74A0A0D2W0R8_GOSRA; Uncharacterized protein
STRINGGorai.012G185900.19e-75(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2065446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-27LOB domain-containing protein 11