PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G1502
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 277aa    MW: 31029.6 Da    PI: 8.324
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G1502genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260106.12.8e-3314107194
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                  aCaaCk++rrkC+++Cv+ap fpa+++++f+ vhk+FG++n++ +l+   ++er++a++sl +eA a+++dPv+G +g++++l+++l++l+  l
  Gh_D05G1502  14 ACAACKHQRRKCESNCVFAPFFPASRAESFREVHKIFGVKNMTGILTPRTPDERKKAVESLEWEALAWTQDPVRGPLGLFRRLEEELQHLNDLL 107
                  7**************************************************************************************9988655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.51713114IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3114108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MSNGEEAAPN TRHACAACKH QRRKCESNCV FAPFFPASRA ESFREVHKIF GVKNMTGILT  60
PRTPDERKKA VESLEWEALA WTQDPVRGPL GLFRRLEEEL QHLNDLLDQL VEPYQQNQMN  120
SAGLNGFNHN SVTGRVIVPN SNINATNIGY GSNPYLGIDV PPIDNYDGVP PISSDGLNEN  180
QLVVNDYFPG YYGIPDRLAV FRESGGVDNV AQTSTPSPTL PPKQETMAQR NQIWGPSRRP  240
LTNNHFPLRN HRRGSQQRYQ YGVLQRPASQ SQGRGLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2271081105LOB family transfactor Ramosa2.1
5ly0_B3e-2271081105LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016732971.10.0PREDICTED: LOB domain-containing protein 6-like
TrEMBLA0A1U8N1L10.0A0A1U8N1L1_GOSHI; LOB domain-containing protein 6-like
STRINGGorai.009G165600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1960367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.19e-27LOB domain-containing protein 2