PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G1133
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 151aa    MW: 16894.1 Da    PI: 8.7485
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G1133genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.31.4e-3951041100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaC++lrr+C++dC+l+pyfp+++p++fa vh+++Gasnv+kll++lp++ r +a++sl++eA++r++dPvyG+vg+i+ lqqq+++++++l +++
  Gh_D05G1133   5 RCAACRYLRRRCTQDCILSPYFPSNNPQRFASVHRIYGASNVTKLLQRLPTHLRAEAADSLYFEAQCRLEDPVYGSVGLIFLLQQQIHSAESQLIKTQ 102
                  6*******************************************************************************************999888 PP

       DUF260  99 ee 100
                  +e
  Gh_D05G1133 103 AE 104
                  75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.2644105IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-395102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MSSGRCAACR YLRRRCTQDC ILSPYFPSNN PQRFASVHRI YGASNVTKLL QRLPTHLRAE  60
AADSLYFEAQ CRLEDPVYGS VGLIFLLQQQ IHSAESQLIK TQAEVAVMKS QTQHPQTQPF  120
RAISGSNNLL LQQSDNDANL SFSNQVSSGF I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-36610512111LOB family transfactor Ramosa2.1
5ly0_B1e-36610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5960922e-79JX596092.1 Gossypium hirsutum clone NBRI_GE32583 microsatellite sequence.
GenBankJX6074012e-79JX607401.1 Gossypium hirsutum clone NBRI_GE47812 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016688888.11e-109PREDICTED: LOB domain-containing protein 24-like
SwissprotP594681e-51LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A1U8JJN71e-107A0A1U8JJN7_GOSHI; LOB domain-containing protein 24-like
STRINGGorai.009G123600.11e-104(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-43LOB domain-containing protein 24