PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G0755
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 811aa    MW: 89745.6 Da    PI: 7.4676
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G0755genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.81.8e-22174275199
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f+k+lt sd++ +g ++ p++ ae++      ++++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + +++el+
  Gh_D05G0755 174 FCKTLTASDTSIHGGFSAPRRAAEDCfprldYKQTRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSVFVSQKNLIAGDAVLFL--RGEDRELR 269
                  99****************************8444556789************************************************..4499999* PP

                  EEEE-S CS
           B3  94 vkvfrk 99 
                  ++++r+
  Gh_D05G0755 270 LGIRRA 275
                  ***996 PP

2Auxin_resp113.22.4e-37300381182
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                  +a+a+stk vF+v+Y+Pras++eFv++++k+ k+++++++ G Rf+m+fe++d +err  G+v+g+ d+dp++WpnSkWr++
  Gh_D05G0755 300 VANALSTKRVFQVCYCPRASHAEFVIPFQKYIKSITNPMCTGARFRMKFEMDDLPERRSNGVVTGIGDSDPYKWPNSKWRCV 381
                  689******************************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-38165285IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-41166286IPR015300DNA-binding pseudobarrel domain
CDDcd100172.31E-21172274No hitNo description
PROSITE profilePS5086312.083174276IPR003340B3 DNA binding domain
SMARTSM010193.1E-21174276IPR003340B3 DNA binding domain
PfamPF023625.4E-21174275IPR003340B3 DNA binding domain
PfamPF065074.8E-30300381IPR010525Auxin response factor
SuperFamilySSF542774.38E-10672755No hitNo description
PfamPF023091.5E-6672761IPR033389AUX/IAA domain
PROSITE profilePS5174521.308676758IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
MEIDLNHAVN EVEKTVLCNG SCEKASACVY CLSSSLSSSS SSSYSSSSCS SNSGSPPCSS  60
SIDLELWHAC AGPLTSLPKK GNVVVYFPQG HLEQLALAFP FSPLDTFDLP PQIFCKVMNV  120
QLLANKENDE VYTQVTLLPQ PELGGHNLGS KQLDEVGADE HADGSPSKPT SHMFCKTLTA  180
SDTSIHGGFS APRRAAEDCF PRLDYKQTRP SQELVAKDLH GVEWRFRHIY RGQPRRHLLT  240
TGWSVFVSQK NLIAGDAVLF LRGEDRELRL GIRRAVRPRT GLPDSIIAKH NSYPKVLSAV  300
ANALSTKRVF QVCYCPRASH AEFVIPFQKY IKSITNPMCT GARFRMKFEM DDLPERRSNG  360
VVTGIGDSDP YKWPNSKWRC VMVRWDDDIA SDHQERVSPW EIDPPVFPPP LSIPSPFRLK  420
KLRTGLQTAA LDTPITGVGY LDFEESTRSS KVLQGQENVG FISPVYGCGT VNHPLNSEMQ  480
SMAHQSLAST GIGKSNISDF MRAHSSSYTG FAETNRFPKV LQGQEICSLR SLTHKADLNL  540
GVWAKTNHGC NSFNMNQAPN TNCYPEGLRN MYFPYNEFYK AGQEPKMYSC ASKLPRGNVL  600
FNASSIKPGV SVDDIRKPNP PNDHKPMENI PSPGFGKKLR NQQNECYKGN VAGCKLFGFS  660
LTAESPTLNS QNSGKRSCTK VHKQGSLVGR AIDLSRLYGY KDLMTELEHL FGMEGLLNDP  720
DKGWRVLYTD RDNDVMVVGD DPWHEFCDVV SKIHIYTGEE VEKMTIGMGS DETQSCLEEA  780
AVIMEASKSS SVGQPDSSPT VMRGMKISVC F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-116474042354Auxin response factor 1
4ldy_B1e-116474042354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.186870.0boll
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6277720.0KJ627772.1 Gossypium hirsutum auxin responsive factor ARF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016689302.10.0PREDICTED: auxin response factor 4-like isoform X1
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A1U8JG550.0A0A1U8JG55_GOSHI; Auxin response factor
STRINGGorai.009G078800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]