PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1893
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 379aa    MW: 42632.7 Da    PI: 7.4828
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1893genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP122.61.7e-38119194176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +Cqv gC++dls+ k+y++r kvCe+hsk+++v+v+g e rfCqqCsrfh l efD++krsCr+rL +hnerrrk 
  Gh_D04G1893 119 QCQVYGCNKDLSSSKDYYKRNKVCEIHSKTAKVIVNGNEMRFCQQCSRFHLLAEFDDGKRSCRKRLVGHNERRRKL 194
                  5*************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-32115181IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.342117194IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-36118197IPR004333Transcription factor, SBP-box
PfamPF031102.7E-31120193IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MDSWSYDCEG KNLFFTDFEA EGMEFNQFMD FSFDYKKKKP FFSNTNLGIF SDEFTTTTSS  60
CYVEQHSSSL MESNSQESSI IDYGDSKGCK ETSVVTSIQP VLISKKASIT TSSCPQTPQC  120
QVYGCNKDLS SSKDYYKRNK VCEIHSKTAK VIVNGNEMRF CQQCSRFHLL AEFDDGKRSC  180
RKRLVGHNER RRKLHFSTLP GKSHKLLQSY RERYEHADQV KFREKPVYDP QSAISIINGK  240
LVSKKQHIPG SFSLATEAFH APNELSGLSC SDCALSLLSS QSRDLSSHAT GIQLTEPFIN  300
QASHHHGSCL ENANGFYSCG MNPMGVSQAG SFRDLGLSSP NGTTVDLLQL STHLQRVEQQ  360
RSSMHVKPEN EDLCYFLTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-261201931184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223310.0KJ622331.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459255.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A0D2S5490.0A0A0D2S549_G
STRINGPOPTR_0008s09750.13e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92752435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-47SBP family protein