PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G0807
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 205aa    MW: 22241.3 Da    PI: 4.7583
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G0807genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.63.7e-42611601100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p+kf ++h++FGasn++k l++lpe++reda+ss+vyeA  r+rdPvyG++g i++lq+q++ l+a+la+++
  Gh_D04G0807  61 PCAACKILRRRCVDKCVLAPYFPPTEPSKFIIAHRVFGASNIIKSLQELPESQREDAVSSMVYEASSRIRDPVYGCAGAIFQLQKQVSDLQAQLAKAQ 158
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_D04G0807 159 AE 160
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.61460161IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4261158IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MENNERGSIS PISIPTTFSY SPSSSSSSPL SQFSPSLPSP DSQSSSPPQA AAASPQLVLS  60
PCAACKILRR RCVDKCVLAP YFPPTEPSKF IIAHRVFGAS NIIKSLQELP ESQREDAVSS  120
MVYEASSRIR DPVYGCAGAI FQLQKQVSDL QAQLAKAQAE VVTLQCQQAN VLTLILEMSQ  180
SKEPIDTTCF LDDTCIVSPW EPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-436016810118LOB family transfactor Ramosa2.1
5ly0_B1e-436016810118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016679407.11e-146PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1U8IMP71e-145A0A1U8IMP7_GOSHI; LOB domain-containing protein 1-like
TrEMBLA0A2P5QGR21e-145A0A2P5QGR2_GOSBA; Uncharacterized protein
STRINGGorai.012G094200.11e-143(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-68LOB domain-containing protein 1