PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G0127
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 214aa    MW: 23376.7 Da    PI: 9.0026
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G0127genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.11.1e-41421411100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lq+q+++l+ae+++++
  Gh_D04G0127  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQHQVQSLQAEVHAVR 139
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_D04G0127 140 AE 141
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.62441142IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-4242139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MARERFDEIG KKIKREGGVS CHQQMGRRHI LSPPGTLNTI TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKMLMEV PESQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISALQHQVQS LQAEVHAVRA ELLKYKYREA NFIPSSLVAL LSSGAVSVAA PPPPPQPPPP  180
PLPTTSTSTS SMYTQLTTAA DYTTISNENV SYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-47341573126LOB family transfactor Ramosa2.1
5ly0_B4e-47341573126LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5257651e-146HQ525765.1 Gossypium herbaceum clone NBRI_D_2250-1 simple sequence repeat marker, mRNA sequence.
GenBankHQ5279961e-146HQ527996.1 Gossypium herbaceum clone NBRI_D_2250-2 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016724389.11e-157PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T56e-82LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A1U8MFQ41e-155A0A1U8MFQ4_GOSHI; LOB domain-containing protein 15-like
STRINGGorai.012G015900.11e-156(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.18e-83LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]