PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G0051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 291aa    MW: 33447.9 Da    PI: 5.0468
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G0051genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.6e-11114156446
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                  +k++rrk +NR AA rsR+RKk++++ Le k+  Le+e ++L 
  Gh_D04G0051 114 DKKQRRKLRNRDAAVRSRERKKMYVKDLEMKSRYLEGECRRLN 156
                  79************************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-12110174No hitNo description
SMARTSM003387.3E-8111175IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.91113155IPR004827Basic-leucine zipper domain
PfamPF001701.8E-10114156IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.41E-10115172No hitNo description
CDDcd147043.07E-15116167No hitNo description
PROSITE patternPS000360118133IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MEETNWESLL FEFDCPNLGN ILQNESESVT PPISTHSPDE KPIWTSSIGE IEKLLMEDDR  60
FDDKVETQPI PNEFLADLLV DSSPSGCGDE VIDDTAFDKQ NQTLFNVDND DPIDKKQRRK  120
LRNRDAAVRS RERKKMYVKD LEMKSRYLEG ECRRLNCLLQ WSIAENQALR FTLNQRCAFD  180
ASSAKQESAV LLLESLLLGS LLWFLGIMCL FTLPRLPKSL LENEEKRGPE RVAHSNLVGQ  240
SFAKTRRCKA SKTKMKDFMF LEFQFHFRLG DDERVSLSYK MTSGGGSHFV S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117123RRKLRNR
2117134RRKLRNRDAAVRSRERKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.81700.0boll| ovule| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO783529900.0
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459325.10.0PREDICTED: bZIP transcription factor 60-like
SwissprotQ69XV03e-35BZP50_ORYSJ; bZIP transcription factor 50
TrEMBLA0A2P5RH680.0A0A2P5RH68_GOSBA; Uncharacterized protein
STRINGGorai.012G007100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.17e-18basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Wakasa Y, et al.
    Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.
    Plant J., 2011. 65(5): p. 675-89
    [PMID:21223397]
  2. Lu SJ, et al.
    Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses.
    Mol Plant, 2012. 5(2): p. 504-14
    [PMID:22199238]