PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G1810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 615aa    MW: 69643.5 Da    PI: 5.6856
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G1810genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3512.81.5e-156534261353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmw+d+m+lkrlke++k+    k+  ++  k+++s+eqar+kkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+k
  Gh_D03G1810  53 DELERRMWRDKMRLKRLKEQNKS----KDG-VDIVKQRQSQEQARKKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDK 145
                  79*******************98....666.99***************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyqa+n i++++++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv pPWWPtG+e+ww++lgl+kdqg+ppyk
  Gh_D03G1810 146 VRFDRNGPAAIAKYQANNSIPGNNDGCNP-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVHPPWWPTGNEEWWPHLGLPKDQGPPPYK 242
                  ***************************88.9******************************************************************* PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedvegkkesk 291
                  kphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee ++++++++s    s+  +s ++++++ +++dveg +++ 
  Gh_D03G1810 243 KPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEETLARELYPESCpplSSGGGSGSLVINDCSEYDVEGADNEP 340
                  *******************************************************************444456666****************777777 PP

                  .XXXXXXXXXX...........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 292 ikhvqavktta...........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                    +vq+ k  +                           ++++ rkrk ++ +s++++ k  ++ c+  q+++se +l+f+d+ ++++++
  Gh_D03G1810 341 NFDVQELKPGNlnssdlsvdrmraiqqppysikgevvnNLDFMRKRK-PSNDSNIMEHK--IYKCEFVQCPYSEHRLGFHDRIARDNHQ 426
                  699******99***********************************9.78888888766..7*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.8E-12953300No hitNo description
Gene3DG3DSA:1.10.3180.107.1E-76174310IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167685.62E-62179303IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MMMFDDMGIC GDMDFFSAPF GEKDAATATL AALRTEPEAT VEDDYSDEEI DVDELERRMW  60
RDKMRLKRLK EQNKSKDGVD IVKQRQSQEQ ARKKKMSRAQ DGILKYMLKM MEVCKAQGFV  120
YGIIPEKGKP VTGASDNLRE WWKDKVRFDR NGPAAIAKYQ ANNSIPGNND GCNPIGPTPH  180
TLQELQDTTL GSLLSALMQH CDPPQRRFPL EKGVHPPWWP TGNEEWWPHL GLPKDQGPPP  240
YKKPHDLKKA WKVGVLTAVI KHMSPDIAKI RKLVRQSKCL QDKMTAKESA TWLAIINQEE  300
TLARELYPES CPPLSSGGGS GSLVINDCSE YDVEGADNEP NFDVQELKPG NLNSSDLSVD  360
RMRAIQQPPY SIKGEVVNNL DFMRKRKPSN DSNIMEHKIY KCEFVQCPYS EHRLGFHDRI  420
ARDNHQLTCP YRNSSALFSG SSFNVNEVKP VILPQAFAQS KPTATAVTSV STPFDLSGLG  480
VPEDGQKMIS ELMSVYDNNI QGSKNMNPSN NPIAEGQNIL HPKIQQPQDE YFRGQGNFFE  540
DSSMPNNHQM FPQGEGQFDR FKGLNSLFET EHNNNNSFPL MFGFPFDLST FDYKEDLQTV  600
GMDTIPRQDV SIWFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B5e-851783102134Protein ETHYLENE INSENSITIVE 3
4zds_A5e-851783102134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.44541e-90boll| leaf| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5269930.0HQ526993.1 Gossypium herbaceum clone NBRI_B_3211 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471478.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_012471477.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_012471476.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_012471475.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_012471474.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0D2QKG70.0A0A0D2QKG7_G
STRINGGLYMA13G03700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein