PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G1361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 176aa    MW: 19587.2 Da    PI: 6.4951
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G1361genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.65.9e-4571061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  Gh_D03G1361   7 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVQQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_D03G1361 105 TE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.056107IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-447104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGSGSSPCAS CKLLRRRCAK DCIFAPYFPS DDPHKFAIVH KVFGASNVSK MLQELPVQQR  60
ADAVSSLVYE ANARVRDPVY GCVGAISYLQ NQVSQLQMQL AVAQTEILCI QMQHNQEDSA  120
LALPTQMQHH DDDDYKPFLL PTTHNLDNIS QYINFASSSN VIQDPAATVK RESLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4821087112LOB family transfactor Ramosa2.1
5ly0_B1e-4821087112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.91470.0ovule
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016713512.11e-130PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-76LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1U8LFW01e-128A0A1U8LFW0_GOSHI; LOB domain-containing protein 12-like
STRINGGorai.003G149600.11e-129(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-79LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]