PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G0606
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 329aa    MW: 36450.3 Da    PI: 9.0281
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G0606genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.41e-32172228158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh hA+rR+Rg+gGrF
  Gh_D03G0606 172 EEPVYVNAKQYHGILRRRQSRAKAELEKKL-IKVRKPYLHESRHLHAMRRARGCGGRF 228
                  69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-37170231IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.337171231IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.0E-27173228IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.6E-24174196IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860176196IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.6E-24205228IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MQLKPYVTNQ PEPNANNNKP YTIGSQPWWS NTRQDSMVTD VLGRNITSLS LVEHPSECLG  60
AKISESLSDG THKICSTKEL PFTILSHPDG KCIVEQPQLQ HAIPIIPPSM GEYVAAPTQM  120
ELVGHSIACP SYPYADPYHR GPMSPYGPQS LVHSHCLGVN SARMALPLEM AEEPVYVNAK  180
QYHGILRRRQ SRAKAELEKK LIKVRKPYLH ESRHLHAMRR ARGCGGRFLN TKKLGTDASN  240
AVPNRGSDSA SSNLSSVGHG ESKESQLQGT NNQQQALSNA NGCYPHHERF LFSTSGSLSD  300
KMMEGDCPRQ QQRERIMANQ VPHMAPTIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-20172232262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.243231e-89ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007028810.11e-157Nuclear factor Y, putative
TrEMBLA0A061EY161e-157A0A061EY16_THECC; Nuclear factor Y, putative
STRINGVIT_08s0007g08250.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156021015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.32e-47nuclear factor Y, subunit A1