PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G0396
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 504aa    MW: 57282.6 Da    PI: 4.7268
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G0396genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3410.51.9e-125323591353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  eelkkrmwkd+ +++rlke ++++  d+       +s  ++e++rrkkmsraQD+iLkYM+k+mevc+aqGfvYgi+pekgkpv+g+sdsLr+WWkek
  Gh_D03G0396  32 EELKKRMWKDRLRMQRLKETRESSSSDH-------QSGVRQEASRRKKMSRAQDSILKYMVKIMEVCKAQGFVYGIVPEKGKPVTGSSDSLRKWWKEK 122
                  8*****************9999865333.......345679********************************************************* PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fd+ +p a+ +     +i+++++    ++ s  h l++lqDTtlgSLLsalmqhc ppqrrfple+g++pPWWPtG+elwwge+g+s++qg+ppy+
  Gh_D03G0396 123 VQFDKSAPLAVDEF--LPIIVEQGEL---DPVSCMHLLHDLQDTTLGSLLSALMQHCVPPQRRFPLERGLAPPWWPTGNELWWGEQGMSQEQGPPPYR 215
                  **********9877..3455554444...589****************************************************************** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsceqkedvegkkeskikh 294
                  kphdlkkawkvsvL+avikhmsp++++ir+l+ qsk+lqdkm+ak++ ++++v+nqee++++            ++ +++s  ++++ e++++ +  +
  Gh_D03G0396 216 KPHDLKKAWKVSVLAAVIKHMSPNLDRIRRLVTQSKCLQDKMTAKDTVTWSKVVNQEEALLK----------LTEKCLKISPTKDDEEEQDSDYSLVA 303
                  **********************************************************9773..........24445556655555555444444333 PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 295 vqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                   + ++  +++++   ++ k+  +++v  + +++ cq+  +++s +el+f+ kn +s++e
  Gh_D03G0396 304 DEGKHG-EKIAISGDKR-KYLFKRQVTPN-MIYACQNTMCPRSAPELGFTGKNTRSDHE 359
                  333333.4455555444.57777778777.57************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.1E-11732273No hitNo description
Gene3DG3DSA:1.10.3180.106.0E-69149277IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.83E-60152276IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MVEILGEIEP PSPVYEAELP EEDEEQEEIS YEELKKRMWK DRLRMQRLKE TRESSSSDHQ  60
SGVRQEASRR KKMSRAQDSI LKYMVKIMEV CKAQGFVYGI VPEKGKPVTG SSDSLRKWWK  120
EKVQFDKSAP LAVDEFLPII VEQGELDPVS CMHLLHDLQD TTLGSLLSAL MQHCVPPQRR  180
FPLERGLAPP WWPTGNELWW GEQGMSQEQG PPPYRKPHDL KKAWKVSVLA AVIKHMSPNL  240
DRIRRLVTQS KCLQDKMTAK DTVTWSKVVN QEEALLKLTE KCLKISPTKD DEEEQDSDYS  300
LVADEGKHGE KIAISGDKRK YLFKRQVTPN MIYACQNTMC PRSAPELGFT GKNTRSDHES  360
SCSYRSKESD VSQESSEESE FSNRNLVPYD HHSFGPQAKL NTDSLGDAQK VLAVTDWLDM  420
ELAKANDQQR NMQSDEVGDI SGTVSQDYIN YLGGAIEDLP VPAEFLLQVG DMDLDPSLPL  480
LLENIQDQEL TSIWDMGFDG ISES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-601502771128Protein ETHYLENE INSENSITIVE 3
4zds_B4e-601502771128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469854.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX161e-142EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A0D2MJ510.0A0A0D2MJ51_G
STRINGVIT_00s0357g00120.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-134EIL family protein