PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G0025
Common NameSPL12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 177aa    MW: 20594.9 Da    PI: 8.0609
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G0025genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP122.81.5e-3865140277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cq+++C adl++ak+yhrrhkvCe h+k + vlv+g++qrfCqqCsrfhe+s+fD +krsCr+rLa+hn rrrk  
  Gh_D03G0025  65 CQADECGADLKDAKQYHRRHKVCEPHAKDAFVLVKGIRQRFCQQCSRFHEISKFDGTKRSCRDRLAGHNLRRRKVV 140
                  *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114129.29962139IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.6E-3165126IPR004333Transcription factor, SBP-box
PfamPF031102.0E-3165138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-3465141IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MEMAKRACKT TVNWVDDDDD EEEEEEQREE RMVKIRVVPR ERYERMNTFI HYSNSAAISG  60
GGGGCQADEC GADLKDAKQY HRRHKVCEPH AKDAFVLVKG IRQRFCQQCS RFHEISKFDG  120
TKRSCRDRLA GHNLRRRKVV QSDQEAENDN SNNKNKASYG KGTATPMLQQ WYQEFTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3159138284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.157261e-178ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223200.0KJ622320.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469239.11e-112PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ6Z4613e-34SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A088DKZ41e-132A0A088DKZ4_G
STRINGVIT_19s0014g02350.t015e-36(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2206745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-33squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]