PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G1515
Common NameSPL20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 474aa    MW: 52187.2 Da    PI: 7.9469
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G1515genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.71.2e-41182259178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC+ dls+ak+yhr+h+vCe hsk+p+v+v gle rfCqqCsrfh+lsefDe+krsCrrrL++hn+rrrk+q+
  Gh_D02G1515 182 RCQVEGCNLDLSSAKDYHRKHRVCESHSKSPKVIVGGLELRFCQQCSRFHALSEFDEKKRSCRRRLSDHNARRRKPQT 259
                  6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-33176244IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.599180257IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.08E-39181263IPR004333Transcription factor, SBP-box
PfamPF031101.1E-32183256IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MDWNAKTPLQ WEWENLMMLN ATPTEIPRKL RSAEWDIEGE EELDSGSLYS SGAAAGGSGG  60
SGSDLGLISL SKSSKSASIN SSSAGEVKVT TFTLEAFEAI PHEISNKKKV SKVEHTGSSP  120
IFEASVGSGE PLLSLKLGKQ TYFEDVCTGS NSKTSSYSAT PGPSPSPAKR SKPNCQTKHI  180
LRCQVEGCNL DLSSAKDYHR KHRVCESHSK SPKVIVGGLE LRFCQQCSRF HALSEFDEKK  240
RSCRRRLSDH NARRRKPQTD AIHFSAARPS PAAYDGKQLM SFVWNKVPFL HNARPNENFT  300
WEGTFVSKSS ETKGYAPTKA GNANGQLQLP GNQLLNSMTS RCYDSNRFLP VKGKQNTVEV  360
LNQGVEESTV ASNMGTTQDL HRALSLLSNE SSVSCEPKQH GSLAYPVHVS GSSMSQPTMN  420
VISQSFPIPY ALSENWQMEQ EQTTQSQVEG DNHLQEFQIL KVPYDNSFYS NQMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-271832561184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1238255KKRSCRRRLSDHNARRRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223280.0KJ622328.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL20) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479136.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012479135.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012479134.10.0PREDICTED: squamosa promoter-binding-like protein 2
RefseqXP_012479133.10.0PREDICTED: squamosa promoter-binding-like protein 2
TrEMBLA0A088DLF90.0A0A088DLF9_G
STRINGVIT_01s0010g03710.t011e-159(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65622644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.37e-79squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]