PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G1113
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family FAR1
Protein Properties Length: 250aa    MW: 28591.2 Da    PI: 7.2563
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G1113genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR192.55.5e-2986173291
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                  fYn+YA++vGF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkw+vtk+++eH+H+lap
  Gh_D02G1113  86 FYNAYATRVGFIIRVSKLSRSRRDGSAIGRALVCNKEGFRMPDKRE--KIVRQRAETRVGCRAMILVRKVSSGKWVVTKFVKEHTHPLAP 173
                  ******************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.5E-2686173IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MDFGVEFGVH GDVNGGMVLN SVQAEASSME NENETGENPV EETFQKELNE KVEQISPGRD  60
DIPEGIPADE PYVGQEFESE AAAHAFYNAY ATRVGFIIRV SKLSRSRRDG SAIGRALVCN  120
KEGFRMPDKR EKIVRQRAET RVGCRAMILV RKVSSGKWVV TKFVKEHTHP LAPGKGRRDC  180
IYDQYPNEHN KIRELTQQLA IEKKRAATYK RHLELIFEQI EEHNESLSKK IQHIVDRVRE  240
IESKEQQNRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.138760.0stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1098667630.0
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478403.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X1
RefseqXP_012478404.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X1
RefseqXP_012478405.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X1
RefseqXP_012478406.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X2
TrEMBLA0A0D2SFJ50.0A0A0D2SFJ5_G
STRINGVIT_05s0102g00690.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73022539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-101FAR1 family protein