PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G0156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family FAR1
Protein Properties Length: 261aa    MW: 30056.1 Da    PI: 7.2835
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G0156genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR190.52.2e-28103190291
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                  fYn+YA++vGF +r+sk ++s+++g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkw+vtk+++eH+H+l+p
  Gh_D02G0156 103 FYNAYATRVGFIIRVSKLSRSRHDGSAIGRALVCNKEGFRMPDKRE--KIMRHRAETRVGCRAMILVRKVSSGKWVVTKFVKEHTHPLTP 190
                  ******************************************9988..99*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-25103190IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MRESLNFEFL LGYIYIYFFT VEFWVHGDVN GGIMLNPVQA EASSSMDNDN ETGENPVEGI  60
FQPGLNEKLD RTSLQRDDIP EIVLADEPYV GQEFESEASA HAFYNAYATR VGFIIRVSKL  120
SRSRHDGSAI GRALVCNKEG FRMPDKREKI MRHRAETRVG CRAMILVRKV SSGKWVVTKF  180
VKEHTHPLTP GKGRTDCIYD QYPNEHDKIR ELTHQLAIEK KRSATYKRQL ELIFEQIDEC  240
NKSLSKKIQH IVDSAREIEN K
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5794471e-123JX579447.1 Gossypium hirsutum clone NBRI_GE11686 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012481542.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X1
TrEMBLA0A0D2RE300.0A0A0D2RE30_G
STRINGPOPTR_0007s01870.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73022539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-105FAR1 family protein