PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G1503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 580aa    MW: 63964.7 Da    PI: 8.1399
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G1503genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.88.4e-40187264178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C+ dls+ak+yhr+h++Ce hsk+p+v+v+g+e+rfCqqCs+fh lsefDe+krsCrrrL++hn+rrrk+q+
  Gh_D01G1503 187 RCQVEDCNFDLSSAKDYHRKHRICESHSKSPKVIVRGQERRFCQQCSKFHGLSEFDEKKRSCRRRLSDHNARRRKPQT 264
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-32182249IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.111185262IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-37186267IPR004333Transcription factor, SBP-box
PfamPF031108.0E-31188261IPR004333Transcription factor, SBP-box
SMARTSM008091.0E-13458577IPR008152Clathrin adaptor, alpha/beta/gamma-adaptin, appendage, Ig-like subdomain
PROSITE profilePS5018018.796461577IPR008153Clathrin adaptor, gamma-adaptin, appendage
PfamPF028831.9E-12488577IPR008152Clathrin adaptor, alpha/beta/gamma-adaptin, appendage, Ig-like subdomain
Gene3DG3DSA:2.60.40.12301.4E-20515579IPR008153Clathrin adaptor, gamma-adaptin, appendage
SuperFamilySSF493481.01E-15516579IPR013041Coatomer/clathrin adaptor appendage, Ig-like subdomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006886Biological Processintracellular protein transport
GO:0016192Biological Processvesicle-mediated transport
GO:0005634Cellular Componentnucleus
GO:0030131Cellular Componentclathrin adaptor complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MSSISPMDWN AKTPLQWDWE NLMMLNATPA EIPRKLRPEE WDIDGEGGIN SGPFYSSGAA  60
GGSGGSGSDL GLASLSKSSK SASINSSSMG EVKMTKFTSE AFEAIPDDIS NQNEAFRAEL  120
AGTSPTLEAS VGSGEPLLSL KLGKQTYFED VSGGSNTKNL SYSSTSGQSP AQAKRSKPNC  180
QGIHVPRCQV EDCNFDLSSA KDYHRKHRIC ESHSKSPKVI VRGQERRFCQ QCSKFHGLSE  240
FDEKKRSCRR RLSDHNARRR KPQTEAFHFS GTRFSSSPND GKQQMSFIWN KVPFLHNARP  300
NEIFTWEGTF DSKSSQMKGY TPTKVGNVNG QPNLPGNQLL NSITMRCHDS NGFLPSKGKQ  360
SVEESRVDSN MATTQDLHRA LSLLSNESWV SCEPKHGSIA YPVHVNPSTS MSQPAMNAIS  420
RGFPSALSEN WQMEQQTTES QVHNSDVKLC CVHWNRRVKL LSLEGCSLLT TEGLEAVILS  480
WQDLENLIVV SCKNINESDI SPALATLFSI LKELFLQLHL DPASSNTLPT SGNGSITQSM  540
KVTNSQHGKK SLVMRIRIAY KINSKDVLEE GQVSNFPRDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-271882611184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243260KKRSCRRRLSDHNARRRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223100.0KJ622310.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467355.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X2
TrEMBLA0A0D2Q8G40.0A0A0D2Q8G4_G
STRINGVIT_01s0010g03710.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65622644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.35e-81squamosa promoter binding protein-like 2