PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G0390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 325aa    MW: 35068.9 Da    PI: 8.3612
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G0390genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822214.52.6e-6621451150
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyr+g+kp e+++++g sa++sp+ss++   
  Gh_D01G0390   2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRNGCKPVERMDIVGGSATVSPCSSYH--- 96 
                  5899*******************************************************************************************... PP

       DUF822  99 kssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                       +sp++sy++sp+sssfpsp+s++ + + +   +sl+p+l++ls++sss+
  Gh_D01G0390  97 -----PSPRASYNPSPASSSFPSPASSSYVVNPNGdvNSLFPWLKNLSSASSSA 145
                  .....*******************9999887766577**********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.1E-653139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RNGCKPVERM DIVGGSATVS PCSSYHPSPR ASYNPSPASS SFPSPASSSY  120
VVNPNGDVNS LFPWLKNLSS ASSSASSSKR PYSYIHGGSI SAPVTPPLSS PTARTPRMKN  180
DWEDQSALPG WSAQQHSFLP SSTPPSPGRQ IVPDPEWFSG LQTPHSRPTS PTFSLVSSNP  240
FGFKEEVLAG GGSRMWTPGQ SGTCSPAIAA GLDQTADVPM SEVISDEFAF GSNATGLVKP  300
WEGERIHEEC GSDDLELTLG SSKTR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.152650.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431160.0AC243116.1 Gossypium raimondii clone GR__Ba0066P11-hvl, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455718.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2
RefseqXP_012455701.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1
SwissprotQ9ZV881e-143BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A0B0NRF70.0A0A0B0NRF7_G
STRINGVIT_19s0014g00870.t011e-162(Vitis vinifera)
STRINGPOPTR_0001s39520.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-126BES1/BZR1 homolog 4