PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G2005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 596aa    MW: 67093.6 Da    PI: 5.0053
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G2005genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN35092.3e-155494061353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++r w+d+m+lkrlk+++k     k+  ++++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+k
  Gh_A13G2005  49 DELERRVWRDKMRLKRLKDQSKG----KDG-VDTAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDK 141
                  79******************998....666.9999*************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyqa+n i++++++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww++lgl+kdqg+p+yk
  Gh_A13G2005 142 VRFDRNGPAAIAKYQADNSIPGNNDGCNL-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGTEEWWPQLGLPKDQGPPSYK 238
                  ***************************99.******************************************************************** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedvegkkesk 291
                  kphdlkkawkv+vLtavikh+sp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++s    s++ +s ++++++ +++d eg  ++ 
  Gh_A13G2005 239 KPHDLKKAWKVGVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPDSCpplSSSGGSGSLVINDCNEYDIEGVVDEP 336
                  *******************************************************************444466677****************999999 PP

                  .XXXXXXXXXX............XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 292 ikhvqavktta............gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  i +vq++k  +            ++++ +krk  ps++  ++ k  ++tc+  q+++se +l+f+d++++++++
  Gh_A13G2005 337 IFDVQECKPGNlnrviqqpsfpvNLDFLQKRK--PSDDINIEHK--IYTCEFLQCPYSELQLGFHDRTARDNHQ 406
                  9********99**********99999**9998..8888887766..8*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.6E-12849296No hitNo description
Gene3DG3DSA:1.10.3180.107.8E-75171306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.24E-61175299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MMMFEEMGIC GDMDFFGASF GEKDVTAASQ VEMDALVDDD YSDEEVDVDE LERRVWRDKM  60
RLKRLKDQSK GKDGVDTAKQ RQSQEQARRK KMSRAQDGIL KYMLKMMEVC KAQGFVYGII  120
PEKGKPVTGA SDNLREWWKD KVRFDRNGPA AIAKYQADNS IPGNNDGCNL IGPTPHTLQE  180
LQDTTLGSLL SALMQHCDPP QRRFPLEKGV PPPWWPTGTE EWWPQLGLPK DQGPPSYKKP  240
HDLKKAWKVG VLTAVIKHIS PDIAKIRKLV RQSKCLQDKM TAKESATWLA IINQEEALAR  300
ELYPDSCPPL SSSGGSGSLV INDCNEYDIE GVVDEPIFDV QECKPGNLNR VIQQPSFPVN  360
LDFLQKRKPS DDINIEHKIY TCEFLQCPYS ELQLGFHDRT ARDNHQLTCP HRNSSAQFGG  420
SNFNINDVKP VIFPPPFAQL KPAAPSTTSV STPFDLSGLG FPEDGQKMIS NLMSIYDNNV  480
QANKNASPIK NPVTEGQNLL QPKTQQQQDE FFRGQGLSFF NESNIPANNQ ILPQGEAQFD  540
RLKTSNSPFE TTYNNNNNGF KLMFGSPFDL SSFDYNDDLQ ADGMDAMPKQ DVSIWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A8e-851743062134Protein ETHYLENE INSENSITIVE 3
4zds_B8e-851743062134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.161320.0boll| ovule| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5270450.0HQ527045.1 Gossypium herbaceum clone NBRI_A2_3611 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462029.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_012462030.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0B0N5D30.0A0A0B0N5D3_G
STRINGGLYMA13G03700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein